| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MIS18A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MIS18A Antibody from Novus Biologicals is a rabbit polyclonal antibody to MIS18A. This antibody reacts with human. The MIS18A Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MIS18A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC |
|---|
| Other Names | B28, C21orf45, C21orf46, FAPP1-associated protein 1, FASP1, hMis18alpha, MIS18 kinetochore protein homolog A (S. pombe), MIS18alpha, protein Mis18-alpha |
|---|
| Gene, Accession # | MIS18A, Gene ID: 54069 |
|---|
| Catalog # | NBP1-88943 |
|---|
| Price | |
|---|
| Order / More Info | MIS18A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|