| Edit |   |
|---|
| Antigenic Specificity | PCMTD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCMTD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCMTD1. This antibody reacts with human. The PCMTD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCMTD1(protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1) The peptide sequence was selected from the middle region of PCMTD1. Peptide sequence TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSV |
|---|
| Other Names | FLJ10883, protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1, protein-L-isoaspartate O-methyltransferase domain-containing protein 1 |
|---|
| Gene, Accession # | PCMTD1, Gene ID: 115294, Accession: Q96MG8, SwissProt: Q96MG8 |
|---|
| Catalog # | NBP1-54370 |
|---|
| Price | |
|---|
| Order / More Info | PCMTD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|