| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PIN/DLC8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PIN/DLC8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PIN/DLC8. This antibody reacts with human. The PIN/DLC8 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PIN/DLC8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV |
|---|
| Other Names | cytoplasmic dynein light polypeptide, DLC1DNCLC1, DLC8MGC126137, DNCL1MGC126138, dynein light chain 1, cytoplasmic, Dynein light chain LC8-type 1, dynein, cytoplasmic, light polypeptide 1, dynein, light chain, LC8-type 1,8 kDa dynein light chain, hdlc1, LC8, PINLC8a, Protein inhibitor of neuronal nitric oxide synthase |
|---|
| Gene, Accession # | DYNLL1, Gene ID: 8655 |
|---|
| Catalog # | NBP2-58509 |
|---|
| Price | |
|---|
| Order / More Info | PIN/DLC8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|