| Edit |   |
|---|
| Antigenic Specificity | C1orf131 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C1orf131 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1orf131. This antibody reacts with human. The C1orf131 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1ORF131 The peptide sequence was selected from the middle region of C1orf131. Peptide sequence TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV. |
|---|
| Other Names | chromosome 1 open reading frame 131, DKFZp547B1713, hypothetical protein LOC128061 |
|---|
| Gene, Accession # | C1ORF131, Gene ID: 128061, Accession: Q8NDD1, SwissProt: Q8NDD1 |
|---|
| Catalog # | NBP1-57829-20ul |
|---|
| Price | |
|---|
| Order / More Info | C1orf131 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|