| Edit |   |
| Antigenic Specificity | C1orf216 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The C1orf216 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1orf216. This antibody reacts with mouse. The C1orf216 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to the C terminal of 5730409E04Rik. Immunizing peptide sequence RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ. |
| Other Names | chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703 |
| Gene, Accession # | C1orf216, Gene ID: 127703, Accession: Q8BP99 |
| Catalog # | NBP1-74251-20ul |
| Price | |
| Order / More Info | C1orf216 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |