| Edit |   |
|---|
| Antigenic Specificity | C1orf216 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The C1orf216 Antibody from Novus Biologicals is a rabbit polyclonal antibody to C1orf216. This antibody reacts with human. The C1orf216 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C1orf216 (chromosome 1 open reading frame 216) The peptide sequence was selected from the N terminal of C1orf216. Peptide sequence GRVEPILRRSSSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGG. |
|---|
| Other Names | chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703 |
|---|
| Gene, Accession # | C1ORF216, Gene ID: 127703, Accession: Q8TAB5, SwissProt: Q8TAB5 |
|---|
| Catalog # | NBP1-69165 |
|---|
| Price | |
|---|
| Order / More Info | C1orf216 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|