| Edit |   |
|---|
| Antigenic Specificity | WDR83OS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WDR83OS Antibody from Novus Biologicals is a rabbit polyclonal antibody to WDR83OS. This antibody reacts with human. The WDR83OS Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C19ORF56 The peptide sequence was selected from the N terminal of C19ORF56. Peptide sequence STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML. |
|---|
| Other Names | C19orf56, chromosome 19 open reading frame 56, hypothetical protein LOC51398, PTD008, WD repeat domain 83 opposite strand |
|---|
| Gene, Accession # | WDR83OS, Gene ID: 51398, Accession: Q9Y284, SwissProt: Q9Y284 |
|---|
| Catalog # | NBP1-59969 |
|---|
| Price | |
|---|
| Order / More Info | WDR83OS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|