| Edit |   |
|---|
| Antigenic Specificity | MCPIP1/ZC3H12A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MCPIP1/ZC3H12A Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCPIP1/ZC3H12A. This antibody reacts with human. The MCPIP1/ZC3H12A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MCPIP1/ZC3H12A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP |
|---|
| Other Names | zinc finger CCCH-type containing 12A |
|---|
| Gene, Accession # | ZC3H12A, Gene ID: 80149, Accession: Q5D1E8, SwissProt: Q5D1E8 |
|---|
| Catalog # | NBP2-37871 |
|---|
| Price | |
|---|
| Order / More Info | MCPIP1/ZC3H12A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|