| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ChGn |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ChGn Antibody from Novus Biologicals is a rabbit polyclonal antibody to ChGn. This antibody reacts with human. The ChGn Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ChGn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIA |
|---|
| Other Names | beta4GalNAcT, Beta4GalNAcT-1, CHGN, chondroitin beta1,4 N-acetylgalactosaminyltransferase, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, chondroitin sulfate N-acetylgalactosaminyltransferase 1, CSGalNAcT-1, EC 2.4.1.174, FLJ11264, FLJ13760, GALNACT1 |
|---|
| Gene, Accession # | CSGALNACT1, Gene ID: 55790 |
|---|
| Catalog # | NBP2-56242 |
|---|
| Price | |
|---|
| Order / More Info | ChGn Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|