| Edit |   |
| Antigenic Specificity | CHIC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CHIC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHIC2. This antibody reacts with human. The CHIC2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to CHIC2(cysteine-rich hydrophobic domain 2) The peptide sequence was selected from the N terminal of CHIC2. Peptide sequence EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI. |
| Other Names | BTLBrX-like translocated in leukemia, cysteine-rich hydrophobic domain 2, cysteine-rich hydrophobic domain 2 protein, cystein-rich hydrophobic domain 2, MGC21173 |
| Gene, Accession # | CHIC2, Gene ID: 26511, Accession: Q9UKJ5, SwissProt: Q9UKJ5 |
| Catalog # | NBP1-59955-20ul |
| Price | |
| Order / More Info | CHIC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |