| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TXNDC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TXNDC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXNDC3. This antibody reacts with human. The TXNDC3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TXNDC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQVVLSEKEAQALCKEYENED |
|---|
| Other Names | CILD6Sptrx-2, EC 2.1.1.31, EC 2.5.1.6, NM23-H8, NME8thioredoxin domain-containing protein 3, Spermatid-specific thioredoxin-2, sperm-specific thioredoxin 2, SPTRX2sptrx-2, thioredoxin domain containing 3 (spermatozoa) |
|---|
| Gene, Accession # | NME8, Gene ID: 51314 |
|---|
| Catalog # | NBP1-85616 |
|---|
| Price | |
|---|
| Order / More Info | TXNDC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|