| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TXNDC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TXNDC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TXNDC5. This antibody reacts with human. The TXNDC5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TXNDC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRT ETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD |
|---|
| Other Names | ENDOPDI, ERP46, FLJ90810, HCC-2, member 15, MGC3178, PDIA15, thioredoxin domain containing 5, thioredoxin domain containing 5 (endoplasmic reticulum), thioredoxin domain-containing protein 5, thioredoxin related protein, TLP46 |
|---|
| Gene, Accession # | TXNDC5, Gene ID: 81567 |
|---|
| Catalog # | NBP2-13497 |
|---|
| Price | |
|---|
| Order / More Info | TXNDC5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|