| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NSUN2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NSUN2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NSUN2. This antibody reacts with human. The NSUN2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NSUN2(NOL1/NOP2/Sun domain family, member 2) The peptide sequence was selected from the C terminal of NSUN2. Peptide sequence FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP. |
|---|
| Other Names | EC 2.1.1, EC 2.1.1.29, FLJ20303,5-methycytoisine methyltransferase, hTrm4, member 2, Myc-induced SUN-domain-containing protein, NOL1/NOP2/Sun domain family 2, NOL1/NOP2/Sun domain family member 2, NOP2/Sun domain family, member 2, SAKIMisu, Substrate of AIM1/Aurora kinase B, TRM4MISU, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog |
|---|
| Gene, Accession # | NSUN2, Gene ID: 54888, Accession: Q08J23, SwissProt: Q08J23 |
|---|
| Catalog # | NBP1-53052 |
|---|
| Price | |
|---|
| Order / More Info | NSUN2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|