| 产品详情 |
| Edit |   |
| Antigenic Specificity | DDX17 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DDX17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX17. This antibody reacts with human. The DDX17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DDX17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQ |
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, DEAD box protein 17, DEAD box protein p72, DEAD/H box 17, DKFZp761H2016, EC 3.6.1, EC 3.6.4.13, P72DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17 (72kD), probable ATP-dependent RNA helicase DDX17, RH70, RNA-dependent helicase p72 |
| Gene, Accession # | DDX17, Gene ID: 10521, Accession: Q92841, SwissProt: Q92841 |
| Catalog # | NBP2-38985 |
| Price | |
| Order / More Info | DDX17 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|