| Edit |   |
|---|
| Antigenic Specificity | IFN-alpha J1/IFNA7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFN-alpha J1/IFNA7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFN-alpha J1/IFNA7. This antibody reacts with human. The IFN-alpha J1/IFNA7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human IFNA7The immunogen for this antibody is IFNA7. Peptide sequence RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ. |
|---|
| Other Names | interferon alpha-7, interferon alpha-J1, interferon, alpha 7 |
|---|
| Gene, Accession # | IFNA7, Gene ID: 3444, Accession: NP_066401, SwissProt: NP_066401 |
|---|
| Catalog # | NBP1-79586 |
|---|
| Price | |
|---|
| Order / More Info | IFN-alpha J1/IFNA7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|