| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Claudin 11 (CLDN11) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyelinating disease. |
|---|
| Immunogen | Claudin 11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH |
|---|
| Other Names | cldn11|fb97c11|wu:fb97c11|claudin-11|CLDN11|Claudin-11|DKFZp459H2322|OSP|OTM|Claudin11|Osp|Otm |
|---|
| Gene, Accession # | Gene ID: 5010,48816 |
|---|
| Catalog # | ABIN634717 |
|---|
| Price | |
|---|
| Order / More Info | Claudin 11 (CLDN11) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|