| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | VCAM-1/CD106 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The VCAM-1/CD106 Antibody from Novus Biologicals is a rabbit polyclonal antibody to VCAM-1/CD106. This antibody reacts with human. The VCAM-1/CD106 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VCAM-1/CD106 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG |
|---|
| Other Names | CD106, CD106 antigen, DKFZp779G2333, INCAM-100, L1CAM, MGC99561, vascular cell adhesion molecule 1, vascular cell adhesion protein 1, V-CAM 1, VCAM1, VCAM-1 |
|---|
| Gene, Accession # | VCAM1, Gene ID: 7412, Accession: P19320, SwissProt: P19320 |
|---|
| Catalog # | NBP2-38223 |
|---|
| Price | |
|---|
| Order / More Info | VCAM-1/CD106 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|