| Edit |   |
|---|
| Antigenic Specificity | EF-Hand Calcium Binding Domain 8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EF-Hand Calcium Binding Domain 8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EF-Hand Calcium Binding Domain 8. This antibody reacts with human. The EF-Hand Calcium Binding Domain 8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EF-Hand Calcium Binding Domain 8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSSEDLAEIPQLQKLSIPHGFQNKEAASSPTPSITLSQVPDLQPGSQLFTEIHLAKIEKMFEEDINSTGALGMDAFIKAMK |
|---|
| Other Names | EFCAB8, EF-Hand Calcium-Binding Domain-Containing Protein 8, EF-Hand Domain-Containing Protein ENSP00000383366 |
|---|
| Gene, Accession # | EFCAB8, Gene ID: 388795, Accession: A8MWE9, SwissProt: A8MWE9 |
|---|
| Catalog # | NBP2-30742 |
|---|
| Price | |
|---|
| Order / More Info | EF-Hand Calcium Binding Domain 8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|