| Edit |   |
| Antigenic Specificity | COX7C |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COX7C Antibody from Novus Biologicals is a rabbit polyclonal antibody to COX7C. This antibody reacts with human. The COX7C Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is COX7C - N-terminal region. Peptide sequence SVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLL. |
| Other Names | Cytochrome c oxidase polypeptide VIIc, cytochrome c oxidase subunit VIIc, cytochrome-c oxidase chain VIIc, mitochondrial |
| Gene, Accession # | COX7C, Gene ID: 1350, Accession: NP_001858, SwissProt: NP_001858 |
| Catalog # | NBP1-98539-20ul |
| Price | |
| Order / More Info | COX7C Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |