| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COX8C |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COX8C Antibody from Novus Biologicals is a rabbit polyclonal antibody to COX8C. This antibody reacts with human. The COX8C Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human COX8C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAE |
|---|
| Other Names | COX VIII-3, COX8-3, cytochrome c oxidase polypeptide 8, Cytochrome c oxidase polypeptide 8 isoform 3, cytochrome c oxidase polypeptide VIII, Cytochrome c oxidase polypeptide VIII isoform 3, Cytochrome c oxidase subunit 8-3, cytochrome c oxidase subunit 8C, cytochrome c oxidase subunit 8C, mitochondrial, cytochrome c oxidase subunit VIII, MGC119774, MGC119775 |
|---|
| Gene, Accession # | COX8C, Gene ID: 341947, Accession: Q7Z4L0 |
|---|
| Catalog # | NBP1-84400 |
|---|
| Price | |
|---|
| Order / More Info | COX8C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|