| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COX4NB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COX4NB Antibody from Novus Biologicals is a rabbit polyclonal antibody to COX4NB. This antibody reacts with human. The COX4NB Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human COX4NB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTL FVD |
|---|
| Other Names | C16orf2, C16orf4, chromosome 16 open reading frame 2, COX4 neighbor, COX4AL, FAM158Bchromosome 16 open reading frame 4, neighbor of COX4, NOC4family with sequence similarity 158, member B, Protein FAM158B |
|---|
| Gene, Accession # | EMC8, Gene ID: 10328 |
|---|
| Catalog # | NBP2-13864 |
|---|
| Price | |
|---|
| Order / More Info | COX4NB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|