| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SENP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 23908357). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SENP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SENP2. This antibody reacts with human. The SENP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SENP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDRRTDDLLELTEDMEKEISNALGHGPQDEILSSAFKL |
|---|
| Other Names | AXAM2Axam2, DKFZp762A2316, EC 3.4.22, EC 3.4.22.68, KIAA1331sentrin-specific protease 2, Sentrin/SUMO-specific protease SENP2, Smt3ip2, SMT3IP2EC 3.4.22.-, SMT3-specific isopeptidase 2, SUMO1/sentrin/SMT3 specific peptidase 2, SUMO1/sentrin/SMT3 specific protease 2 |
|---|
| Gene, Accession # | SENP2, Gene ID: 59343 |
|---|
| Catalog # | NBP1-88920 |
|---|
| Price | |
|---|
| Order / More Info | SENP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23908357 |
|---|
| 产品资料 |
|
|