| Edit |   |
| Antigenic Specificity | PCBP3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCBP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCBP3. This antibody reacts with human. The PCBP3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI. |
| Other Names | Alpha-CP3, poly (rC)-binding protein 310ALPHA-CP3, poly(rC) binding protein 3, poly(rC)-binding protein 3 |
| Gene, Accession # | PCBP3, Gene ID: 54039, Accession: P57721, SwissProt: P57721 |
| Catalog # | NBP1-57325-20ul |
| Price | |
| Order / More Info | PCBP3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |