| Edit |   |
|---|
| Antigenic Specificity | PCBP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PCBP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PCBP3. This antibody reacts with human. The PCBP3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI. |
|---|
| Other Names | Alpha-CP3, poly (rC)-binding protein 310ALPHA-CP3, poly(rC) binding protein 3, poly(rC)-binding protein 3 |
|---|
| Gene, Accession # | PCBP3, Gene ID: 54039, Accession: P57721, SwissProt: P57721 |
|---|
| Catalog # | NBP1-57325 |
|---|
| Price | |
|---|
| Order / More Info | PCBP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|