| Edit |   |
|---|
| Antigenic Specificity | Fructosamine 3 Kinase Related Protein (FN3KRP) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation. |
|---|
| Immunogen | FN3 KRP antibody was raised using the N terminal of FN3 RP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA |
|---|
| Other Names | fn3k|fn3kl|MGC145992|DKFZP469K211|FN3KL|FN3K-RP|RGD1304570 |
|---|
| Gene, Accession # | Gene ID: 79672 |
|---|
| Catalog # | ABIN631861 |
|---|
| Price | |
|---|
| Order / More Info | Fructosamine 3 Kinase Related Protein (FN3KRP) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|