| Edit |   |
| Antigenic Specificity | PCDH7 |
| Clone | 2D7 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PCDH7 Antibody (2D7) from Novus Biologicals is a mouse monoclonal antibody to PCDH7. This antibody reacts with human. The PCDH7 Antibody (2D7) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | PCDH7 (NP_002580, 31 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KQLLRYRLAEEGPADVRIGNVASDLGIVTGSGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPSQSWV |
| Other Names | BH-PcdhBHPCDHprotocadherin-7, BH-protocadherin (brain-heart), Brain-heart protocadherin, protocadherin 7 |
| Gene, Accession # | PCDH7, Gene ID: 5099, Accession: NP_002580, SwissProt: NP_002580 |
| Catalog # | H00005099-M01 |
| Price | |
| Order / More Info | PCDH7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |