Edit |   |
Antigenic Specificity | Fructose-1,6-Bisphosphatase 2 (FBP2) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. |
Immunogen | FBP2 antibody was raised using the middle region of FBP2 corresponding to a region with amino acids YIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQ |
Other Names | FBP2|MGC108013|FBP|Fbp-1|Fbp1|Rae-30|zgc:101083|FBPase|6330409F21Rik|Fbp2|Fubp2|Ksrp |
Gene, Accession # | Gene ID: 8789 |
Catalog # | ABIN631953 |
Price | |
Order / More Info | Fructose-1,6-Bisphosphatase 2 (FBP2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |