| Edit |   |
|---|
| Antigenic Specificity | hnRNP AB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The hnRNP AB Antibody from Novus Biologicals is a rabbit polyclonal antibody to hnRNP AB. This antibody reacts with human. The hnRNP AB Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to HNRPAB The peptide sequence was selected from the N terminal of HNRPAB. Peptide sequence GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK. |
|---|
| Other Names | catalytic polypeptide 1-binding protein 1, heterogeneous nuclear ribonucleoprotein A/B, hnRNP A/B, hnRNP type A/B protein |
|---|
| Gene, Accession # | HNRNPAB, Gene ID: 3182, Accession: Q99729, SwissProt: Q99729 |
|---|
| Catalog # | NBP1-57172-20ul |
|---|
| Price | |
|---|
| Order / More Info | hnRNP AB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|