| Edit |   |
|---|
| Antigenic Specificity | ADAMTSL2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 98%, rat 100%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ADAMTSL2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VMSAYAMCVRYDGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECS |
|---|
| Other Names | ADAMTS-like 2, KIAA0605 |
|---|
| Gene, Accession # | Gene ID: 9719, UniProt: Q86TH1, ENSG00000197859 |
|---|
| Catalog # | HPA053812 |
|---|
| Price | |
|---|
| Order / More Info | ADAMTSL2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|