| Edit |   |
|---|
| Antigenic Specificity | mGluR2 |
|---|
| Clone | 3H7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mGluR2 Antibody (3H7) from Novus Biologicals is a mouse monoclonal antibody to mGluR2. This antibody reacts with human. The mGluR2 Antibody (3H7) has been validated for the following applications: ELISA. |
|---|
| Immunogen | GRM2 (NP_000830 414 a.a. - 506 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NGRRLYKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTLDTSLIPWASPSAGPLAASRCSEPCLQ |
|---|
| Other Names | GLUR2, glutamate metabotropic receptor 2, glutamate receptor, metabotropic 2, GPRC1Bmetabotropic glutamate receptor 2, mGlu2, mGluR2, MGLUR2glutamate receptor homolog |
|---|
| Gene, Accession # | GRM2, Gene ID: 2912, Accession: NP_000830, SwissProt: NP_000830 |
|---|
| Catalog # | H00002912-M03 |
|---|
| Price | |
|---|
| Order / More Info | mGluR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|