| 产品详情 |
| Edit |   |
| Antigenic Specificity | Ribonuclease Inhibitor |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Ribonuclease Inhibitor Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ribonuclease Inhibitor. This antibody reacts with human. The Ribonuclease Inhibitor Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Ribonuclease Inhibitor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LCETLLEPGCQLESLWVKSCSFTAACCSHFSSVLAQNRFLLELQISNNRLEDAGVRELCQGLGQPGSVLRVLWLADCDVSDSSCSSLAATLLAN |
| Other Names | Placental ribonuclease inhibitor, Placental RNase inhibitor, PRI, RAIMGC4569, ribonuclease inhibitor, ribonuclease/angiogenin inhibitor, ribonuclease/angiogenin inhibitor 1MGC18200, RNHMGC54054 |
| Gene, Accession # | RNH1, Gene ID: 6050 |
| Catalog # | NBP1-87161 |
| Price | |
| Order / More Info | Ribonuclease Inhibitor Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|