| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NUDT15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT15. This antibody reacts with human. The NUDT15 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NUDT15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL |
|---|
| Other Names | 8-oxo-dGTPase NUDT15, A730068G11Rik, EC 3.1.6.-, FLJ10956, MTH2MGC104352, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15, nudix (nucleoside diphosphate linked moiety X)-type motif 15, Nudix motif 15, nudix-type motif 15, probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15, RP11-90M2.1 |
|---|
| Gene, Accession # | NUDT15, Gene ID: 55270, Accession: Q9NV35, SwissProt: Q9NV35 |
|---|
| Catalog # | NBP2-38436 |
|---|
| Price | |
|---|
| Order / More Info | NUDT15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|