| Edit |   |
|---|
| Antigenic Specificity | NUDT17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NUDT17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NUDT17. This antibody reacts with human. The NUDT17 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human NUDT17. Peptide sequence YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD. |
|---|
| Other Names | nudix (nucleoside diphosphate linked moiety X)-type motif 17, nudix motif 17 |
|---|
| Gene, Accession # | NUDT17, Gene ID: 200035, Accession: NP_001012776, SwissProt: NP_001012776 |
|---|
| Catalog # | NBP1-91325 |
|---|
| Price | |
|---|
| Order / More Info | NUDT17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|