| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CROP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CROP Antibody from Novus Biologicals is a rabbit polyclonal antibody to CROP. This antibody reacts with human, mouse, rat. The CROP Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat CROP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERER |
|---|
| Other Names | cAMP regulatory element-associated protein 1, cisplatin resistance associated overexpressed protein, cisplatin resistance-associated overexpressed protein, Cisplatin resistance-associated-overexpressed protein, CREAP1, CREAP-1LUC7ACRA, CRE-associated protein 1, CROPFLJ11063, hLuc7A, Luc7A, LUC7-like 3 (S. cerevisiae), luc7-like protein 3, O48, OA48-18, Okadaic acid-inducible phosphoprotein OA48-18 |
|---|
| Gene, Accession # | LUC7L3, Gene ID: 51747 |
|---|
| Catalog # | NBP1-88052 |
|---|
| Price | |
|---|
| Order / More Info | CROP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|