| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZC3H7A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZC3H7A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZC3H7A. This antibody reacts with human. The ZC3H7A Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ZC3H7A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: REHDWNNSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGR |
|---|
| Other Names | FLJ10027, FLJ20318, HSPC055, ZC3H7, ZC3HDC7, zinc finger CCCH domain-containing protein 7A, zinc finger CCCH type domain containing 7, zinc finger CCCH-type containing 7, zinc finger CCCH-type containing 7A, zinc finger CCCH-type domain containing 7, zinc-finger protein AY163807 |
|---|
| Gene, Accession # | ZC3H7A, Gene ID: 29066 |
|---|
| Catalog # | NBP2-56811 |
|---|
| Price | |
|---|
| Order / More Info | ZC3H7A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|