| Edit |   |
|---|
| Antigenic Specificity | ZC3HAV1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZC3HAV1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZC3HAV1L. This antibody reacts with human. The ZC3HAV1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ZC3HAV1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RDCWSTCTLSHDIHTPVNMQVLKSHGLFGLNENQLRILLLQNDPCLLPEVCLLYNKGEALYGYCNLKDKCNKFHVCKSF |
|---|
| Other Names | C7orf39, chromosome 7 open reading frame 39, MGC14289, zinc finger CCCH-type antiviral protein 1-like, zinc finger CCCH-type, antiviral 1-like |
|---|
| Gene, Accession # | ZC3HAV1L, Gene ID: 92092 |
|---|
| Catalog # | NBP2-58199 |
|---|
| Price | |
|---|
| Order / More Info | ZC3HAV1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|