| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCR8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCR8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCR8. This antibody reacts with human. The CCR8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MDYTLDLSVTTVTDYYYPDIFSSPCDGELIQTNGKLLL |
|---|
| Other Names | CC chemokine receptor 8, C-C CKR-8, CC-chemokine receptor chemr1, CC-CKR-8, CCR-8, CDw198, CDw198 antigen, chemokine (C-C motif) receptor 8, chemokine (C-C) receptor 8, chemokine (C-C) receptor-like 2, Chemokine receptor-like 1, CKR-L1, CKRL1MGC129966, CMKBR8MGC129973, CMKBRL2C-C chemokine receptor type 8, CY6, GPRCY6, GPR-CY6, TER1CC chemokine receptor CHEMR1 |
|---|
| Gene, Accession # | CCR8, Gene ID: 1237 |
|---|
| Catalog # | NBP2-68645 |
|---|
| Price | |
|---|
| Order / More Info | CCR8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|