| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PHLDA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHLDA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHLDA1. This antibody reacts with human. The PHLDA1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PHLDA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQAILAVKSTRQKQQHLVQQQP |
|---|
| Other Names | Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich protein, Proline- and histidine-rich protein, proline-histidine rich protein, TDAG51PQR protein |
|---|
| Gene, Accession # | PHLDA1, Gene ID: 22822 |
|---|
| Catalog # | NBP2-56404 |
|---|
| Price | |
|---|
| Order / More Info | PHLDA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|