| Edit |   |
|---|
| Antigenic Specificity | PHOSPHO1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PHOSPHO1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PHOSPHO1. This antibody reacts with human. The PHOSPHO1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is PHOSPHO1 - C-terminal region. Peptide sequence GLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRASVVPWETAADVRLHLQ. |
|---|
| Other Names | EC 3.1.3.75, phosphatase, orphan 1, phosphoethanolamine/phosphocholine phosphatase |
|---|
| Gene, Accession # | PHOSPHO1, Gene ID: 162466, Accession: NP_001137276, SwissProt: NP_001137276 |
|---|
| Catalog # | NBP1-98553-20ul |
|---|
| Price | |
|---|
| Order / More Info | PHOSPHO1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|