| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SERCA2 ATPase |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SERCA2 ATPase Antibody from Novus Biologicals is a rabbit polyclonal antibody to SERCA2 ATPase. This antibody reacts with human. The SERCA2 ATPase Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SERCA2 ATPase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPA |
|---|
| Other Names | ATP2BFLJ20293, ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2, Calcium pump 2, Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletalmuscle isoform, cardiac Ca2+ ATPase, DAR, DD, EC 3.6.3, EC 3.6.3.8, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, FLJ38063, MGC45367, sarcoplasmic/endoplasmic reticulum calcium ATPase 2, SERCA2DKFZp686P0211, SR Ca(2+)-ATPase 2 |
|---|
| Gene, Accession # | ATP2A2, Gene ID: 488, Accession: P16615, SwissProt: P16615 |
|---|
| Catalog # | NBP2-34147 |
|---|
| Price | |
|---|
| Order / More Info | SERCA2 ATPase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|