| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ErbB2/Her2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ErbB2/Her2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ErbB2/Her2. This antibody reacts with human. The ErbB2/Her2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ErbB2/Her2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAHYKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPC |
|---|
| Other Names | CD340, CD340 antigen, c-erb B2/neu protein, EC 2.7.10, EGFR2, HER-2, HER2EC 2.7.10.1, herstatin, Metastatic lymph node gene 19 protein, MLN 19, MLN19, NEUHER-2/neu, neuroblastoma/glioblastoma derived oncogene homolog, NGLTKR1, p185erbB2, Proto-oncogene c-ErbB-2, Proto-oncogene Neu, receptor tyrosine-protein kinase erbB-2, Tyrosine kinase-type cell surface receptor HER2, v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog), v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomaderived oncogene homolog (avian) |
|---|
| Gene, Accession # | ERBB2, Gene ID: 2064 |
|---|
| Catalog # | NBP2-55224 |
|---|
| Price | |
|---|
| Order / More Info | ErbB2/Her2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|