| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TIMM13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TIMM13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIMM13. This antibody reacts with human. The TIMM13 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human TIMM13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKC IGKPGGSLDNSEQKCIAMCMDRYMD |
|---|
| Other Names | mitochondrial import inner membrane translocase subunit Tim13, mitochondrial import inner membrane translocase subunit Tim13B, ppv1, Tim13, TIM13B, TIMM13A, TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B, translocase of inner mitochondrial membrane 13 homolog (yeast) |
|---|
| Gene, Accession # | TIMM13, Gene ID: 26517 |
|---|
| Catalog # | NBP2-13431 |
|---|
| Price | |
|---|
| Order / More Info | TIMM13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|