| Edit |   |
| Antigenic Specificity | Gonadotropin Inducible Transcription Repressor 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Gonadotropin Inducible Transcription Repressor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Gonadotropin Inducible Transcription Repressor 1. This antibody reacts with human. The Gonadotropin Inducible Transcription Repressor 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptide directed towards the N terminal of human GIOT-1. Peptide sequence QHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFS. |
| Other Names | zinc finger protein 213, Zinc finger protein with KRAB and SCAN domains 21, ZKSCAN21CR53Putative transcription factor CR53 |
| Gene, Accession # | ZNF461, Gene ID: 92283, Accession: AAH28631, SwissProt: AAH28631 |
| Catalog # | NBP1-80177-20ul |
| Price | |
| Order / More Info | Gonadotropin Inducible Transcription Repressor 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |