| Edit |   |
|---|
| Antigenic Specificity | Chymotrypsin-like protease |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Chymotrypsin-like protease Antibody from Novus Biologicals is a rabbit polyclonal antibody to Chymotrypsin-like protease. This antibody reacts with human. The Chymotrypsin-like protease Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS. |
|---|
| Other Names | chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821 |
|---|
| Gene, Accession # | CTRL, Gene ID: 1506, Accession: P40313, SwissProt: P40313 |
|---|
| Catalog # | NBP1-58002 |
|---|
| Price | |
|---|
| Order / More Info | Chymotrypsin-like protease Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|