Edit |   |
Antigenic Specificity | PDIA2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 73%, rat 35%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PDIA2 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LIGGRDLVVIGFFQDLQDEDVATFLALAQDALDMTFGLTDRPRLFQQFGLTKDTV |
Other Names | protein disulfide isomerase family A, member 2, PDA2, PDI, PDIP, PDIR |
Gene, Accession # | Gene ID: 64714, UniProt: Q13087, ENSG00000185615 |
Catalog # | HPA053492 |
Price | |
Order / More Info | PDIA2 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |