| Edit |   |
|---|
| Antigenic Specificity | ULBP-3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF reaction per custiomer image. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ULBP-3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ULBP-3. This antibody reacts with human. The ULBP-3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ULBP-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM |
|---|
| Other Names | NKG2D ligand 3, RAET1N, UL16 binding protein 3 |
|---|
| Gene, Accession # | ULBP3, Gene ID: 79465, Accession: Q9BZM4, SwissProt: Q9BZM4 |
|---|
| Catalog # | NBP2-31866 |
|---|
| Price | |
|---|
| Order / More Info | ULBP-3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26361968, 27621649, 27734028 |
|---|