| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RAX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAX2. This antibody reacts with human. The RAX2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RAX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLG |
|---|
| Other Names | CORD11, MGC15631, QRXQ50-type retinal homeobox protein, RAXL1ARMD6, retina and anterior neural fold homeobox 2, retina and anterior neural fold homeobox like 1, retina and anterior neural fold homeobox protein 2, Retina and anterior neural fold homeobox-like protein 1 |
|---|
| Gene, Accession # | RAX2, Gene ID: 84839, Accession: Q96IS3, SwissProt: Q96IS3 |
|---|
| Catalog # | NBP2-33654 |
|---|
| Price | |
|---|
| Order / More Info | RAX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|