| Edit |   |
|---|
| Antigenic Specificity | SLC26A10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC26A10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC26A10. This antibody reacts with human. The SLC26A10 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human SLC26A10. Peptide sequence MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV. |
|---|
| Other Names | solute carrier family 26, member 10 |
|---|
| Gene, Accession # | SLC26A10, Gene ID: 65012, Accession: NP_597996, SwissProt: NP_597996 |
|---|
| Catalog # | NBP1-80393 |
|---|
| Price | |
|---|
| Order / More Info | SLC26A10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|