| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC26A3 |
|---|
| Clone | 2E3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC26A3 Antibody (2E3) from Novus Biologicals is a mouse monoclonal antibody to SLC26A3. This antibody reacts with human. The SLC26A3 Antibody (2E3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | SLC26A3 (NP_000102 503 a.a. - 600 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT |
|---|
| Other Names | chloride anion exchanger, CLD, congenital chloride diarrhea, down-regulated in adenoma protein, DRADown-regulated in adenoma, Protein DRA, Solute carrier family 26 member 3, solute carrier family 26, member 3 |
|---|
| Gene, Accession # | SLC26A3, Gene ID: 1811, Accession: NP_000102, SwissProt: NP_000102 |
|---|
| Catalog # | H00001811-M01 |
|---|
| Price | |
|---|
| Order / More Info | SLC26A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21474426 |
|---|
| 产品资料 |
|
|