| Edit |   |
|---|
| Antigenic Specificity | TCTA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TCTA Antibody from Novus Biologicals is a rabbit polyclonal antibody to TCTA. This antibody reacts with human. The TCTA Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TCTA(T-cell leukemia translocation altered gene) The peptide sequence was selected from the middle region of TCTA. Peptide sequence IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR. |
|---|
| Other Names | T-cell leukemia translocation altered gene, T-cell leukemia translocation-altered gene protein, T-cell leukemia translocation-associated gene protein |
|---|
| Gene, Accession # | TCTA, Gene ID: 6988, Accession: P57738, SwissProt: P57738 |
|---|
| Catalog # | NBP1-59828 |
|---|
| Price | |
|---|
| Order / More Info | TCTA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|